PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00092.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 451aa    MW: 51368.7 Da    PI: 6.417
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00092.1_g00008.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.11.4e-083694071854
                              HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              +F++  ++yp+ +e+  LA + gL+ +qV++WF N R +
  Rsa1.0_00092.1_g00008.1 369 MFQNflHPYPTDSEKHLLAIRSGLSRSQVSNWFINARVR 407
                              5887779******************************88 PP

2BELL87.31.7e-28244314172
                     BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              +r++l++kk++Ll ll++Vd+rY+++v++++tv+s+F+a+++l++ +++ ++Al++iS+ +++L+++i+++i
  Rsa1.0_00092.1_g00008.1 244 QRRALEAKKTHLLGLLQMVDDRYSHCVDEIHTVVSAFHAATELDP-QLHSRFALQTISFLYKNLRERISKKI 314
                              6899*****************************************.***********************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.0E-41175312IPR006563POX domain
PfamPF075266.3E-26180311IPR006563POX domain
PROSITE profilePS5007111.37348411IPR001356Homeobox domain
CDDcd000865.76E-11351412No hitNo description
SMARTSM003893.4E-6351415IPR001356Homeobox domain
SuperFamilySSF466891.45E-15352420IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-25354417IPR009057Homeodomain-like
PfamPF059203.0E-15368407IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MDNDNTFSSL DNVMTNQNNL LMDLIPSRED STSFSTMLPW NSMRSDPLQT GGYDIFNSFL  60
TNKYLSSTSS SINVQEPRHF ESFEVMAPPL PPLHHLDHLR PYDDSSNNMW SLGEISGFHA  120
YSCVEGVVGP SEPVTCTFAE EDVSDECSEI SPCAATKSTR ITSEQASSSS RDISNNVSQV  180
VFGSKYLHSV QEILSNFATY SLYGLENNPQ CYLPSQGTES EAADSAFTSR FENQPEFLEG  240
GFDQRRALEA KKTHLLGLLQ MVDDRYSHCV DEIHTVVSAF HAATELDPQL HSRFALQTIS  300
FLYKNLRERI SKKILMLGSV LERGKEKCQE NSIIHQHCLL QQLKHKNHQI WRPQRGLPEK  360
SVSVLRTWMF QNFLHPYPTD SEKHLLAIRS GLSRSQVSNW FINARVRLWK PMIEEMYAEM  420
NKKKLNNTHL QGNGGSRRLP KSIMMSQERD I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895650.0AC189565.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH009C15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013719632.10.0PREDICTED: homeobox protein ATH1-like
SwissprotP487310.0ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A0D3DHE80.0A0A0D3DHE8_BRAOL; Uncharacterized protein
STRINGBra037031.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM82282637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.10.0homeobox gene 1